PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.0032s0330.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family Dof
Protein Properties Length: 327aa    MW: 35774.5 Da    PI: 9.033
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.0032s0330.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof120.17.8e-383191262
                  zf-Dof  2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62
                            +++ +kcprC+s ntkfCyynny+lsqPryfCk+CrryWt GG+lrnvPvGgg+rk k+++
  SapurV1A.0032s0330.1.p 31 PQQPKKCPRCESLNTKFCYYNNYNLSQPRYFCKTCRRYWTLGGTLRNVPVGGGCRKGKRAK 91
                            67899***************************************************99875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF027014.0E-323389IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.6023589IPR003851Zinc finger, Dof-type
ProDomPD0074782.0E-233689IPR003851Zinc finger, Dof-type
PROSITE patternPS0136103773IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 327 aa     Download sequence    Send to blast
MQGGGEDVTP NQERRLKSAQ GDDPQQHHQP PQQPKKCPRC ESLNTKFCYY NNYNLSQPRY  60
FCKTCRRYWT LGGTLRNVPV GGGCRKGKRA KTSSSSSSGE TSRFHQQPQL LQHNLAAPQN  120
ILATNNSGNL SCPVLRNKES GNLVSPPPGM SPMGSYFPGG GLLTSLEAIQ SLNTNQPPLQ  180
SFPPQPLNQP VNLGGVLGET SNLGFLHGFN TVPPFGSQNQ HQIQFYHVGD RDTKSYEHSF  240
YPHNRESSII SSSRPATSSH DQQQNWHHGF MNSSNPTVSD TALWSTSTST TVGHTNSNMI  300
NTTVGSSPLI PDQWKHDHLP GFGPPS*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006377380.11e-173hypothetical protein POPTR_0011s05410g
TrEMBLU5G1111e-173U5G111_POPTR; Uncharacterized protein
STRINGPOPTR_0011s05410.11e-173(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF41453258
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60850.13e-32OBF binding protein 4